gp

GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2Db molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM. GP(33-41) Epitope is a strong agonist of CD8 T cells from P14 TCR-transgenic mice.

Gp100 (25-33) corresponds to residues 25 to 33 of the mouse self/tumor antigen glycoprotein (mgp100), which is an enzyme responsible for pigment synthesis. This epitope fragment is found in both normal melanocytes and melanoma cells.

LCMV GP (61-80) is a 61-80 amino acid sequence peptide fragment derived from the lymphocytic choroid plexus meningitis virus (LCMV) glycoprotein (GP), which is a specific antigenic determinant that induces CD4+ T cell responses.

This is a HLA-A*0201 restricted epitope used in melanoma studies.

Gp100 (25-33), human is the amino acids 25-33 fragment of the human melanoma antigen. It is a 9-amino acid (AA) epitope restricted by H-2Db and recognized by the T cells.This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db res

LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an H-2Db restricted epitope derived from the lymphocytic choriomeningitis virus (LCMV) glycoprotein gp 33 (residues 33 to 41) and is presented to cytotoxic T lymphocytes by MHC class I H-2Db molecules.

GP(33-41) TFA, a 9-amino-acid (aa) peptide, represents the optimal sequence of the lymphocytic choriomeningitis virus GP1 epitope, effectively upregulating H-2D b molecules on the RMA-S (Db Kb) cell surface with an SC50 value of 344 nM [1].

GP-2B, an antimicrobial peptide, exhibits antibacterial activity against Gram-positive strains, with a minimum inhibitory concentration (MIC) ranging from 8 to 128 μg/mL for S. aureus and Enterococcus faecalis [1].

Gp100 (25-33), human TFA is a 25-33 amino acid fragment of human melanoma antigen.Gp100 (25-33), human TFA is a 9-amino acid (AA) epitopes restricted by h-2db and recognized by T cells.

LCMV gp33-41 (TFA), an 11-amino-acid carboxyl-extended peptide, comprises a lymphocytic choriomeningitis virus sequence that is presented by MHC class I H-2Db molecules to cytotoxic T lymphocytes [1].

GP120, HIV-1 MN, a peptide, is utilized in researching HIV infection [1] [2].

gp91 ds-tat is a NADPH oxidase (NOX2) inhibitor that reduces NOX2 expression.

Affibody (affibody) ligands that are specific for the extracellular domain of human epidermal growth factor receptor 2 (HER2/neu) have been selected by phage display technology from a combinatorial protein library based on the 58 amino acid residue staphy

HER2/neu (654-662) GP2 acetate is derived from the human epidermal growth factor receptor 2 (HER2-Neu, 654–662). HER2/neu (654-662) GP2 acetate induces HLA-A2-restricted cytotoxic T lymphocytes reactive to various epithelial cancers.

LCMV gp33-41 acetate is a sequence of lymphocytic choriomeningitis virus which restricted by major histocompatibility complex class I H-2Db and presented to cytotoxic T lymphocytes.

HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF) is a polypeptide molecule with the sequence AVGIGALFLGFLGAAGSTMGARS-NH2.

HIV (gp41) Fragment AVGIGA is a polypeptide molecule with the sequence AVGIGA.

Gp100 (25-33), mouse TFA is a sequence located at residues 25-33 of the mouse self/tumor antigen glycoprotein (Mgp100). This enzyme participates in pigment synthesis, and its epitope fragment is expressed in both normal melanocytes and melanoma cells.

GPLGIAGQ acetate is a MMP2-cleavable polypeptide. GPLGIAGQ acetate can be used as a stimulus-sensitive linker in both liposomal and micellar nanocarriers to synthesis unique MMP2-targeted photosensitizer in photodynamic therapy.

Positive allosteric modulator of GABAB receptors

GPRP (Gly-Pro-Arg-Pro) is a fibrin polymerization inhibitor that inhibits the interaction between fibrinogen and the platelet membrane glycoprotein IIb/IIIa complex (glycoprotein IIb/IIIa receptor).

N-(p-Tosyl)-GPR-pNA acetate is a colorimetric substrate for thrombin that can act as a measure of thrombin activity.

Orphan GPCR SP9155 agonist P550 (mouse, rat) (26RFa (mouse, rat)) is an RFamide peptide family member with an orexigenic effect, acting as the cognate ligand for the mouse orphan receptor GPR103, also known as SP9155 or AQ27.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.