Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: GPX5, Glutathione peroxidase 5 (GPx-5;GSHPx-5), Epididymis-specific glutathione peroxidase-like protein (EGLP), Epididymal secretory glutathione peroxidase

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $143 | 20 days | 20 days | |
| 10 µg | $238 | 20 days | 20 days | |
| 20 µg | $397 | 20 days | 20 days | |
| 50 µg | $597 | 20 days | 20 days | |
| 100 µg | $845 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction. GPX5 Protein, Pig, Recombinant (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 26.1 kDa and the accession number is O18994. |
| Species | Sus scrofa (Pig) |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis, C-Myc |
| Accession Number | O18994 |
| Amino Acid | NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE |
| Construction | 22-219 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | GPX5, Glutathione peroxidase 5 (GPx-5;GSHPx-5), Epididymis-specific glutathione peroxidase-like protein (EGLP), Epididymal secretory glutathione peroxidase |
| Research Background | May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction. |
| Molecular Weight | 26.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.