TRIM65 Protein, Human, Recombinant (His)

Catalog No. TMPH-03777

TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.

TRIM65 Protein, Human, Recombinant (His)

Catalog No. TMPH-03777

TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.

Pack Size	Price	USA Warehouse	Global Warehouse	Quantity

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.
Species	Human
Expression System	Yeast
Tag	C-6xHis
Accession Number	P43003
Synonyms	Tripartite motif-containing protein 65,TRIM65,E3 ubiquitin-protein ligase TRIM65
Amino Acid	HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Construction	146-236 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	64.1 kDa (Predicted); 66 kDa (Reducing conditions)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice.