Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

TRIM65 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-03777

TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.

TRIM65 Protein, Human, Recombinant (His)

TRIM65 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-03777
TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$9820 days20 days
10 μg$16120 days20 days
20 μg$256-In Stock
50 μg$38320 days20 days
100 μg$48020 days20 days
1 mg$2,06020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.
Species
Human
Expression System
Yeast
TagC-6xHis
Accession NumberP43003
Synonyms
Tripartite motif-containing protein 65,TRIM65,E3 ubiquitin-protein ligase TRIM65
Amino Acid
HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Construction
146-236 aa
Protein Purity
> 85% as determined by SDS-PAGE.
TRIM65 Protein, Human, Recombinant (His)
Molecular Weight64.1 kDa (Predicted); 66 kDa (Reducing conditions)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords