Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Triacylglyceride transfer protein LprG, lprG, lpp-27, Lipoprotein LprG, Lipoarabinomannan carrier protein LprG, Antigen P27, 27 kDa lipoprotein


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | LprG Protein, Mycobacterium tuberculosis, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 29.2 kDa and the accession number is P9WK44. |
| Species | Mycobacterium tuberculosis |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P9WK44 |
| Amino Acid | CSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS |
| Construction | 27-236 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Triacylglyceride transfer protein LprG, lprG, lpp-27, Lipoprotein LprG, Lipoarabinomannan carrier protein LprG, Antigen P27, 27 kDa lipoprotein |
| Research Background | Probably helps membrane protein MT1454 (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm and probably ultimately to the outer membrane. TAG probably regulates lipid metabolism and growth regulation. Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2. Required for activity of drug efflux transporter MT1454. Required, probably with MT1454, for normal surface localization of LAM.; Constitutes a host TLR2 agonist (toll-like receptor). |
| Molecular Weight | 29.2 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.