NLRP3 Protein, Mouse, Recombinant (His & SUMO)

Name: NLRP3 Protein, Mouse, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-02796
Rating: 4.5 (1 reviews)

(Synonyms: PYRIN-containing APAF1-like protein 1, Pypaf1, Nlrp3, Nalp3, NACHT, LRR and PYD domains-containing protein 3, Mmig1, Mast cell maturation-associated-inducible protein 1, LRR and PYD domains-containing protein 3, Cryopyrin, Cold autoinflammatory syndrome 1 protein homolog, Cias1) Copy Product Info

Synonyms: PYRIN-containing APAF1-like protein 1, Pypaf1, Nlrp3, Nalp3, NACHT, LRR and PYD domains-containing protein 3, Mmig1, Mast cell maturation-associated-inducible protein 1, LRR and PYD domains-containing protein 3, Cryopyrin, Cold autoinflammatory syndrome 1 protein homolog, Cias1

Catalog No. TMPH-02796 Copy Product Info

NLRP3 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 34.2 kDa and the accession number is Q8R4B8.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NLRP3 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 34.2 kDa and the accession number is Q8R4B8.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q8R4B8
Amino Acid	MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR
Construction	1-153 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PYRIN-containing APAF1-like protein 1, Pypaf1, Nlrp3, Nalp3, NACHT, LRR and PYD domains-containing protein 3, Mmig1, Mast cell maturation-associated-inducible protein 1, LRR and PYD domains-containing protein 3, Cryopyrin, Cold autoinflammatory syndrome 1 protein homolog, Cias1
Research Background	As the sensor component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. In response to pathogens and other damage-associated signals, initiates the formation of the inflammasome polymeric complex, made of NLRP3, PYCARD and CASP1 (or possibly CASP4/CASP11). Recruitment of proCASP1 to the inflammasome promotes its activation and CASP1-catalyzed IL1B and IL18 maturation and secretion in the extracellular milieu. Activation of NLRP3 inflammasome is also required for HMGB1 secretion. The active cytokines and HMGB1 stimulate inflammatory responses. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death. Under resting conditions, NLRP3 is autoinhibited. NLRP3 activation stimuli include extracellular ATP, reactive oxygen species, K(+) efflux, crystals of monosodium urate or cholesterol, amyloid-beta fibers, environmental or industrial particles and nanoparticles, cytosolic dsRNA, etc. However, it is unclear what constitutes the direct NLRP3 activator. Activation in presence of cytosolic dsRNA is mediated by DHX33. Independently of inflammasome activation, regulates the differentiation of T helper 2 (Th2) cells and has a role in Th2 cell-dependent asthma and tumor growth. During Th2 differentiation, required for optimal IRF4 binding to IL4 promoter and for IRF4-dependent IL4 transcription. Binds to the consensus DNA sequence 5'-GRRGGNRGAG-3'. May also participate in the transcription of IL5, IL13, GATA3, CCR3, CCR4 and MAF.

Chemical Properties

Molecular Weight

34.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.