PFD0110w Protein, Plasmodium falciparum, Recombinant

Name: PFD0110w Protein, Plasmodium falciparum, Recombinant
Brand: TargetMol
SKU: TMPH-03143
Rating: 4.5 (1 reviews)

(Synonyms: RH1, Reticulocyte-binding protein homolog 1, PfRH1, Normocyte-binding protein 1 (PfNBP1), NBP1) Copy Product Info

Synonyms: RH1, Reticulocyte-binding protein homolog 1, PfRH1, Normocyte-binding protein 1 (PfNBP1), NBP1

Catalog No. TMPH-03143 Copy Product Info

PFD0110w Protein, Plasmodium falciparum, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is P86148.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$185	20 days	20 days
10 µg	$297	20 days	20 days
20 µg	$515	20 days	20 days
50 µg	$713	20 days	20 days
100 µg	$916	20 days	20 days
200 µg	$1,260	20 days	20 days
500 µg	$1,930	20 days	20 days
1 mg	$2,690	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PFD0110w Protein, Plasmodium falciparum, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is P86148.
Species	Plasmodium falciparum
Expression System	E. coli
Tag	Tag Free
Accession Number	P86148
Amino Acid	QESYSSNEKIRKDYSDDNNYEPTPSYEKRKKEYGKDESYIKNYRGNNFSYDLSKNSSIFLHMGNGSNSKTLKRCNKKKNIKTNFLRPIEEEKTVLNNYVYKGVNFLDTIKRNDSSYKFDVYKDTSFLKNREYKELITMQYDYAYLEATKEVLYLIPKDKDYHKFYKNELEKILFNLKDSLKLLREGYIQSKLEMIRIHSDIDILNEFHQGNIINDNYFNNEIKKKKEDMEKYIREYNLYIYKYENQ
Construction	24-269 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	RH1, Reticulocyte-binding protein homolog 1, PfRH1, Normocyte-binding protein 1 (PfNBP1), NBP1
Research Background	During the asexual blood stage, binds to a sialic acid containing receptor on the surface of the host erythrocyte and thus is involved in merozoite invasion. Binds erythrocytes via a neuraminidase sensitive and trypsin-, chymotrypsin-resistant receptor. After merozoite attachment and reorientation, RH1 binding to its erythrocyte receptor triggers an increase in intracellular Ca(2+) within the parasite resulting in the release of microneme proteins such as EBA175 which in turn leads to the formation of the tight junction between parasite and host cell.

Chemical Properties

Molecular Weight

30.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

RH 1PfRH 1PfNBP1PfNBP 1NBP 1

Related Tags: PFD0110w Protein, Plasmodium falciparum, Recombinant chemical structure | PFD0110w Protein, Plasmodium falciparum, Recombinant molecular weight