Shopping Cart
Remove All
Your shopping cart is currently empty
PFD0110w Protein, Plasmodium falciparum, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is P86148.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $185 | 20 days | 20 days | |
| 10 μg | $297 | 20 days | 20 days | |
| 20 μg | $515 | 20 days | 20 days | |
| 50 μg | $713 | 20 days | 20 days | |
| 100 μg | $916 | 20 days | 20 days | |
| 200 μg | $1,260 | 20 days | 20 days | |
| 500 μg | $1,930 | 20 days | 20 days | |
| 1 mg | $2,690 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | PFD0110w Protein, Plasmodium falciparum, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is P86148. |
| Species | Plasmodium falciparum |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P86148 |
| Synonyms | RH1,Reticulocyte-binding protein homolog 1,PfRH1,Normocyte-binding protein 1 (PfNBP1),NBP1 |
| Amino Acid | QESYSSNEKIRKDYSDDNNYEPTPSYEKRKKEYGKDESYIKNYRGNNFSYDLSKNSSIFLHMGNGSNSKTLKRCNKKKNIKTNFLRPIEEEKTVLNNYVYKGVNFLDTIKRNDSSYKFDVYKDTSFLKNREYKELITMQYDYAYLEATKEVLYLIPKDKDYHKFYKNELEKILFNLKDSLKLLREGYIQSKLEMIRIHSDIDILNEFHQGNIINDNYFNNEIKKKKEDMEKYIREYNLYIYKYENQ |
| Construction | 24-269 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 30.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | During the asexual blood stage, binds to a sialic acid containing receptor on the surface of the host erythrocyte and thus is involved in merozoite invasion. Binds erythrocytes via a neuraminidase sensitive and trypsin-, chymotrypsin-resistant receptor. After merozoite attachment and reorientation, RH1 binding to its erythrocyte receptor triggers an increase in intracellular Ca(2+) within the parasite resulting in the release of microneme proteins such as EBA175 which in turn leads to the formation of the tight junction between parasite and host cell. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.