PTGES3 Protein, Human, Recombinant (E. coli, His)

Name: PTGES3 Protein, Human, Recombinant (E. coli, His)
Brand: TargetMol
SKU: TMPH-01925
Rating: 4.5 (1 reviews)

(Synonyms: Telomerase-binding protein p23, TEBP, PTGES3, Prostaglandin E synthase 3, Progesterone receptor complex p23, P23, Hsp90 co-chaperone, Cytosolic prostaglandin E2 synthase (cPGES)) Copy Product Info

Synonyms: Telomerase-binding protein p23, TEBP, PTGES3, Prostaglandin E synthase 3, Progesterone receptor complex p23, P23, Hsp90 co-chaperone, Cytosolic prostaglandin E2 synthase (cPGES)

Catalog No. TMPH-01925 Copy Product Info

PTGES3 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 μg	$89	20 days	20 days
10 μg	$143	20 days	20 days
20 μg	$237	20 days	20 days
50 μg	$358	20 days	20 days
100 μg	$490	20 days	20 days
200 μg	$755	20 days	20 days
500 μg	$1,330	20 days	20 days
1 mg	$2,080	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PTGES3 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q15185
Amino Acid	MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Construction	1-160 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Telomerase-binding protein p23, TEBP, PTGES3, Prostaglandin E synthase 3, Progesterone receptor complex p23, P23, Hsp90 co-chaperone, Cytosolic prostaglandin E2 synthase (cPGES)
Research Background

Chemical Properties

Molecular Weight

24.2 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

PTGES 3P 23Hsp 90 co-chaperonecPGES

Related Tags: PTGES3 Protein, Human, Recombinant (E. coli, His) chemical structure | PTGES3 Protein, Human, Recombinant (E. coli, His) molecular weight