CXCL5 Protein, Human, Recombinant (His) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 198.00 | |
100 μg | 20 days | $ 389.00 | |
1 mg | 20 days | $ 1,680.00 |
Description | CXCL5 Protein, Human, Recombinant (His) is expressed in E. coli. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 6xHis-tagged |
Accession Number | P42830 |
Synonyms | Epithelial-derived neutrophil-activating protein 78, SCYB5, ENA78, Small-inducible cytokine B5, ENA-78(1-78), C-X-C motif chemokine 5, Neutrophil-activating peptide ENA-78, CXCL5 |
Amino Acid | AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 37-110 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 11.9 kDa as predicted |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CXCL5 Protein, Human, Recombinant (His) Epithelial-derived neutrophil-activating protein 78 SCYB5 ENA78 Small-inducible cytokine B5 ENA-78(1-78) C-X-C motif chemokine 5 Neutrophil-activating peptide ENA-78 CXCL5 recombinant recombinant-proteins proteins protein