Shopping Cart
Remove All
Your shopping cart is currently empty
PTGES3 Protein, Human, Recombinant (His) is expressed in Yeast.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $105 | - | In Stock | |
| 10 μg | $169 | - | In Stock | |
| 20 μg | $283 | 20 days | 20 days | |
| 50 μg | $428 | 20 days | 20 days | |
| 100 μg | $589 | 20 days | 20 days | |
| 200 μg | $890 | 20 days | 20 days | |
| 500 μg | $1,620 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | PTGES3 Protein, Human, Recombinant (His) is expressed in Yeast. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-10xHis |
| Accession Number | Q15185 |
| Synonyms | Telomerase-binding protein p23,TEBP,PTGES3,Prostaglandin E synthase 3,Progesterone receptor complex p23,P23,Hsp90 co-chaperone,Cytosolic prostaglandin E2 synthase (cPGES) |
| Amino Acid | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
| Construction | 1-160 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 21.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.