PTGES3 Protein, Human, Recombinant (His)

Name: PTGES3 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01926
Price: 105 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Telomerase-binding protein p23, TEBP, PTGES3, Prostaglandin E synthase 3, Progesterone receptor complex p23, P23, Hsp90 co-chaperone, Cytosolic prostaglandin E2 synthase (cPGES)) Copy Product Info

Synonyms: Telomerase-binding protein p23, TEBP, PTGES3, Prostaglandin E synthase 3, Progesterone receptor complex p23, P23, Hsp90 co-chaperone, Cytosolic prostaglandin E2 synthase (cPGES)

Catalog No. TMPH-01926 Copy Product Info

Purity: 98%

PTGES3 Protein, Human, Recombinant (His) is expressed in Yeast.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	-	In Stock
10 µg	$169	-	In Stock
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$589	20 days	20 days
200 µg	$890	20 days	20 days
500 µg	$1,620	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PTGES3 Protein, Human, Recombinant (His) is expressed in Yeast.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-10xHis
Accession Number	Q15185
Amino Acid	MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Construction	1-160 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Telomerase-binding protein p23, TEBP, PTGES3, Prostaglandin E synthase 3, Progesterone receptor complex p23, P23, Hsp90 co-chaperone, Cytosolic prostaglandin E2 synthase (cPGES)
Research Background	Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.

Chemical Properties

Molecular Weight

21.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.