Midkine Protein, Chicken, Recombinant (His & Myc)

Catalog No. TMPH-00378 Copy Product Info

Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.

Midkine Protein, Chicken, Recombinant (His & Myc)

Catalog No. TMPH-00378

Copy Product Info

Midkine Protein, Chicken, Recombinant (His & Myc)

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	-	In Stock
10 μg	$216	-	In Stock
20 μg	$360	-	In Stock
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.
Species	Chicken
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P24052
Synonyms	RIHB,Retinoic acid-induced heparin-binding protein (RI-HB),Midkine
Amino Acid	AKAKKEKMKKEGSECQDWHWGPCIPNSKDCGLGYREGSCGDESRKLKCKIPCNWKKKFGADCKYKFESWGGCSAKTGVKTRSGILKKALYNAECEEVVYVSKPCTAKMKAKAKAKKGKGKD
Construction	22-142 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	20.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Has mitogenic activity, and neurite extension activity for PC12 cells.