Midkine Protein, Chicken, Recombinant (His & Myc)

Catalog No. TMPH-00378

Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.

Midkine Protein, Chicken, Recombinant (His & Myc)

Catalog No. TMPH-00378

Pack Size	Price	Availability
5 μg	$129	In Stock
10 μg	$216	In Stock
20 μg	$360	In Stock
50 μg	$543	20 days
100 μg	$745	20 days
200 μg	$1,070	20 days
500 μg	$1,730	20 days
1 mg	$2,530	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.
Species	Chicken
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P24052
Synonyms	RIHB,Retinoic acid-induced heparin-binding protein (RI-HB),Midkine
Amino Acid	AKAKKEKMKKEGSECQDWHWGPCIPNSKDCGLGYREGSCGDESRKLKCKIPCNWKKKFGADCKYKFESWGGCSAKTGVKTRSGILKKALYNAECEEVVYVSKPCTAKMKAKAKAKKGKGKD
Construction	22-142 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	20.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Has mitogenic activity, and neurite extension activity for PC12 cells.