Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Midkine Protein, Chicken, Recombinant (His & Myc)

Catalog No. TMPH-00378

Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.

Midkine Protein, Chicken, Recombinant (His & Myc)

Midkine Protein, Chicken, Recombinant (His & Myc)

Catalog No. TMPH-00378
Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.
Pack SizePriceAvailabilityQuantity
20 μg $360In Stock
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Has mitogenic activity, and neurite extension activity for PC12 cells. Midkine Protein, Chicken, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is P24052.
Species
Chicken
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP24052
Synonyms
RIHB,Retinoic acid-induced heparin-binding protein (RI-HB),Midkine
Amino Acid
AKAKKEKMKKEGSECQDWHWGPCIPNSKDCGLGYREGSCGDESRKLKCKIPCNWKKKFGADCKYKFESWGGCSAKTGVKTRSGILKKALYNAECEEVVYVSKPCTAKMKAKAKAKKGKGKD
Construction
22-142 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight20.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Has mitogenic activity, and neurite extension activity for PC12 cells.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords