Shopping Cart
- Remove All
- Your shopping cart is currently empty
Neuromedin S (human), a 33-amino acid neuropeptide, serves as an endogenous ligand for the orphan G-protein coupled receptor (GPCR) FM-4/TGR-1, and acts on the neuromedin U (NMU) receptor 2 (NMUR2) to regulate body weight homeostasis [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Neuromedin S (human), a 33-amino acid neuropeptide, serves as an endogenous ligand for the orphan G-protein coupled receptor (GPCR) FM-4/TGR-1, and acts on the neuromedin U (NMU) receptor 2 (NMUR2) to regulate body weight homeostasis [1]. |
Cas No. | 1138204-27-9 |
Sequence | Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 |
Sequence Short | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.