Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

NOV/CCN3 Protein, Human, Recombinant

(Synonyms: Protein NOV homolog (NovH), NOVH, NOV, Nephro blastoma-overexpressed gene protein homolog, Insulin-like growth factor-binding protein 9 (IBP-9;IGF-binding protein 9;IGFBP-9), IGFBP9, Cellular communication network factor 3, CCN3, CCN family member 3) Copy Product Info

Synonyms: Protein NOV homolog (NovH), NOVH, NOV, Nephro blastoma-overexpressed gene protein homolog, Insulin-like growth factor-binding protein 9 (IBP-9;IGF-binding protein 9;IGFBP-9), IGFBP9, Cellular communication network factor 3, CCN3, CCN family member 3

Catalog No. TMPH-04089 Copy Product Info
NOV/CCN3 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P48745.
NOV/CCN3 Protein, Human, Recombinant
TargetMol | Customer service
Customer service consultation
Pack SizePriceUSA StockGlobal StockQuantity
5 µg$1477-10 days7-10 days
10 µg$2477-10 days7-10 days
20 µg$4277-10 days7-10 days
50 µg$8907-10 days7-10 days
100 µg$1,5507-10 days7-10 days
200 µg$2,2207-10 days7-10 days
500 µg$3,5807-10 days7-10 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1.0 μg/ml, corresponding to a specific activity of >1000 IU/mg.
Description
NOV/CCN3 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P48745.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP48745
Amino AcidM+QVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Construction28-357 aa
Protein Purity
>95% as determined by SDS-PAGE.
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.6, 150 mM NaCl.
ReconstitutionReconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
SynonymsProtein NOV homolog (NovH), NOVH, NOV, Nephro blastoma-overexpressed gene protein homolog, Insulin-like growth factor-binding protein 9 (IBP-9;IGF-binding protein 9;IGFBP-9), IGFBP9, Cellular communication network factor 3, CCN3, CCN family member 3
Chemical Properties
Molecular Weight36.2 kDa (Predicted)
Storage & Solubility Information
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
StorageLyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Keywords

Related Tags: NOV/CCN3 Protein, Human, Recombinant chemical structure | NOV/CCN3 Protein, Human, Recombinant molecular weight