RO60 Protein, Human, Recombinant (His)

Name: RO60 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00864
Rating: 4.5 (1 reviews)

(Synonyms: TROVE2, TROVE domain family member 2, SSA2, Sjoegren syndrome type A antigen (SS-A), Sjoegren syndrome antigen A2, RO60, Ro 60 kDa autoantigen (Ro60 autoantigen), RNA-binding protein RO60, 60 kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein;60 kDa ribonucleoprotein Ro;RoRNP)) Copy Product Info

Synonyms: TROVE2, TROVE domain family member 2, SSA2, Sjoegren syndrome type A antigen (SS-A), Sjoegren syndrome antigen A2, RO60, Ro 60 kDa autoantigen (Ro60 autoantigen), RNA-binding protein RO60, 60 kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein;60 kDa ribonucleoprotein Ro;RoRNP)

Catalog No. TMPH-00864 Copy Product Info

RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.; May play roles in cilia formation and/or maintenance. RO60 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 64.1 kDa and the accession number is P10155.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:Greater than 85% as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.; May play roles in cilia formation and/or maintenance. RO60 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 64.1 kDa and the accession number is P10155.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P10155
Amino Acid	ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL
Construction	3-535 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	TROVE2, TROVE domain family member 2, SSA2, Sjoegren syndrome type A antigen (SS-A), Sjoegren syndrome antigen A2, RO60, Ro 60 kDa autoantigen (Ro60 autoantigen), RNA-binding protein RO60, 60 kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein;60 kDa ribonucleoprotein Ro;RoRNP)
Research Background	RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.; May play roles in cilia formation and/or maintenance.

Chemical Properties

Molecular Weight

64.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.