Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc)

Catalog No. TMPH-01456

Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) is expressed in E. coli.

Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc)

Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc)

Catalog No. TMPH-01456
Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$360In Stock
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) is expressed in E. coli.
Species
HHV-6B
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberQ9QJ11
Synonyms
HCLF1 protein,gQ1,Glycoprotein Q-80k (gQ-80k),Glycoprotein Q1,Glycoprotein 105 (gp105)
Amino Acid
TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK
Construction
25-354 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight44.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays a role in virus entry by participating in host receptor binding at the cell surface.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords