Shopping Cart

Your shopping cart is currently empty

Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc)

Name: Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc)
Brand: TargetMol
SKU: TMPH-01456
Rating: 4.5 (1 reviews)

(Synonyms: HCLF1 protein, gQ1, Glycoprotein Q-80k (gQ-80k), Glycoprotein Q1, Glycoprotein 105 (gp105)) Copy Product Info

Synonyms: HCLF1 protein, gQ1, Glycoprotein Q-80k (gQ-80k), Glycoprotein Q1, Glycoprotein 105 (gp105)

Catalog No. TMPH-01456 Copy Product Info

Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	-	In Stock
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:Greater than 85% as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) is expressed in E. coli.
Species	HHV-6B
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q9QJ11
Amino Acid	TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK
Construction	25-354 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	HCLF1 protein, gQ1, Glycoprotein Q-80k (gQ-80k), Glycoprotein Q1, Glycoprotein 105 (gp105)
Research Background	Plays a role in virus entry by participating in host receptor binding at the cell surface.

Chemical Properties

Molecular Weight

44.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

HCLF-1 proteingQ-80kgQ80kgQ 1gp105gp 105Glycoprotein Q-1

Related Tags: Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) chemical structure | Human herpesvirus 6B (HHV-6 variant B) (strain Z29) Glycoprotein Q1 (His & Myc) molecular weight