SMOC2 Protein, Human, Recombinant (His)

Catalog No. TMPH-04134

SMOC2 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9H3U7.

SMOC2 Protein, Human, Recombinant (His)

Catalog No. TMPH-04134

SMOC2 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9H3U7.

Pack Size	Price	Availability
5 μg	$129	20 days
10 μg	$216	20 days
20 μg	$360	20 days
50 μg	$516	20 days
100 μg	$678	20 days
200 μg	$978	20 days
500 μg	$1,590	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SMOC2 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9H3U7.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q9H3U7
Synonyms	SPARC-related modular calcium-binding protein 2,Smooth muscle-associated protein 2 (SMAP-2),SMOC2,SMAP2,Secreted modular calcium-binding protein 2 (SMOC-2)
Amino Acid	QKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRHTPRGHAESTSNRQPRKQG
Construction	22-446 aa
Protein Purity	>85% as determined by SDS-PAGE.
Molecular Weight	54.4 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.