Shopping Cart
Remove All
Your shopping cart is currently empty
ID1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.1 kDa and the accession number is P41134.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $75 | 20 days | 20 days | |
| 10 μg | $119 | 20 days | 20 days | |
| 20 μg | $198 | 20 days | 20 days | |
| 50 μg | $297 | 20 days | 20 days | |
| 100 μg | $427 | 20 days | 20 days | |
| 200 μg | $658 | 20 days | 20 days | |
| 500 μg | $1,170 | 20 days | 20 days | |
| 1 mg | $1,830 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ID1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.1 kDa and the accession number is P41134. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P41134 |
| Synonyms | Inhibitor of DNA binding 1,Inhibitor of differentiation 1,ID1,ID,DNA-binding protein inhibitor ID-1,Class B basic helix-loop-helix protein 24 (bHLHb24),BHLHB24 |
| Amino Acid | MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
| Construction | 1-155 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 32.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.