PLAA Protein, Mouse, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 13.6 kDa and the accession number is P27612.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 491.00 | |
100 μg | 20 days | $ 1,370.00 |
Description | PLAA Protein, Mouse, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 13.6 kDa and the accession number is P27612. |
Species | Mouse |
Expression System | Baculovirus |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Accession Number | P27612 |
Amino Acid | TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 495-584 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 13.6 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha (TNF-alpha)- or lipopolysaccharide (LPS)-dependent manner, and hence prostaglandin E2 biosynthesis. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein