USP26 Protein, Human, Recombinant (His)

Name: USP26 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02284
Rating: 4.5 (1 reviews)

(Synonyms: USP26, Ubiquitin-specific-processing protease 26, Ubiquitin thioesterase 26, Ubiquitin carboxyl-terminal hydrolase 26, Deubiquitinating enzyme 26) Copy Product Info

Synonyms: USP26, Ubiquitin-specific-processing protease 26, Ubiquitin thioesterase 26, Ubiquitin carboxyl-terminal hydrolase 26, Deubiquitinating enzyme 26

Catalog No. TMPH-02284 Copy Product Info

Involved in the ubiquitin-dependent proteolytic pathway in conjunction with the 26S proteasome. Deubiquitinates the androgen receptor and regulates the androgen receptor signaling pathway.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Involved in the ubiquitin-dependent proteolytic pathway in conjunction with the 26S proteasome. Deubiquitinates the androgen receptor and regulates the androgen receptor signaling pathway.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q9BXU7
Amino Acid	EKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIFHGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQVFADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAHPSSIQSTFDLFFGAEELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKVIRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGKPASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRPTKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFYMHNEIFE
Construction	291-890 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	USP26, Ubiquitin-specific-processing protease 26, Ubiquitin thioesterase 26, Ubiquitin carboxyl-terminal hydrolase 26, Deubiquitinating enzyme 26
Research Background

Chemical Properties

Molecular Weight

72.4 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

USP 26

Related Tags: USP26 Protein, Human, Recombinant (His) chemical structure | USP26 Protein, Human, Recombinant (His) molecular weight