Shopping Cart
- Remove All
- Your shopping cart is currently empty
PACAP (1-38), human, ovine, rat (Pituitary Adenylate Cyclase Activating Polypeptide 38), is a neuropeptide comprising 38 amino acid residues.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
500 μg | $98 | In Stock | |
1 mg | $143 | In Stock | |
5 mg | $349 | In Stock | |
10 mg | $519 | In Stock | |
25 mg | $846 | In Stock |
Description | PACAP (1-38), human, ovine, rat (Pituitary Adenylate Cyclase Activating Polypeptide 38), is a neuropeptide comprising 38 amino acid residues. |
Targets&IC50 | PAC1vs:121 nM(Ki), PAC1:1.1 nM(Ki) , PAC1s:1.7 nM(Ki) |
In vitro | Pituitary adenylate cyclase-activating polypeptide with 38 residues (PACAP 1-38) dramatically prevents injury of cultured renal proximal tubule cells caused by myeloma light chains through suppression of proinflammatory cytokines production, by inhibiting p38 MAPK and translocation of NFkappaB via both PAC(1) and VPAC(1) receptors[1]. |
Alias | Pituitary Adenylate Cyclase Activating Polypeptide 38, PACAP 1-38 |
Molecular Weight | 4534.26 |
Formula | C203H331N63O53S |
Cas No. | 137061-48-4 |
Relative Density. | no data available |
Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.