Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Ag85C Protein, Mycobacterium tuberculosis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03007 Copy Product Info
Ag85C Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P9WQN8.

Ag85C Protein, Mycobacterium tuberculosis, Recombinant (His)

Catalog No. TMPH-03007
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Ag85C Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P9WQN8.

Ag85C Protein, Mycobacterium tuberculosis, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Ag85C Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P9WQN8.
Species
Mycobacterium tuberculosis
Expression System
E. coli
TagN-6xHis
Accession NumberP9WQN8
Synonyms
mpt45,Fibronectin-binding protein C (Fbps C),fbpC,Diacylglycerol acyltransferase/mycolyltransferase Ag85C,DGAT,Antigen 85 complex C (85C;Ag85C),Acyl-CoA:diacylglycerol acyltransferase
Amino Acid
AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Construction
46-340 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight36.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords