GPX3 Protein, Human, Recombinant (U73C, hFc)

Name: GPX3 Protein, Human, Recombinant (U73C, hFc)
Brand: TargetMol
SKU: TMPH-03938
Rating: 4.5 (1 reviews)

(Synonyms: Plasma glutathione peroxidase (GPx-P;GSHPx-P), GSHPx-3, GPXP, GPx-3, GPX3, Glutathione peroxidase 3, Extracellular glutathione peroxidase) Copy Product Info

Synonyms: Plasma glutathione peroxidase (GPx-P;GSHPx-P), GSHPx-3, GPXP, GPx-3, GPX3, Glutathione peroxidase 3, Extracellular glutathione peroxidase

Catalog No. TMPH-03938 Copy Product Info

GPX3 Protein, Human, Recombinant (U73C, hFc) is expressed in HEK293 Cells with N-hFc. The accession number is P22352.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$133	20 days	20 days
10 µg	$219	20 days	20 days
20 µg	$368	20 days	20 days
50 µg	$643	20 days	20 days
100 µg	$987	20 days	20 days
200 µg	$1,530	20 days	20 days
500 µg	$2,770	20 days	20 days
1 mg	$4,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	GPX3 Protein, Human, Recombinant (U73C, hFc) is expressed in HEK293 Cells with N-hFc. The accession number is P22352.
Species	Human
Expression System	HEK293 Cells
Tag	N-hFc
Accession Number	P22352
Amino Acid	QSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Construction	21-226 aa (U73C)
Protein Purity	>90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Plasma glutathione peroxidase (GPx-P;GSHPx-P), GSHPx-3, GPXP, GPx-3, GPX3, Glutathione peroxidase 3, Extracellular glutathione peroxidase

Chemical Properties

Molecular Weight

49.5 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.