Shopping Cart
Remove All
Your shopping cart is currently empty
Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2]. |
| In vitro | Prolactin Releasing Peptide (1-31), human (acetate), shows high affinity for the GPR10 receptor in humans and rats, with Ki values of 1.03 nM and 0.33 nM, respectively [1]. |
| In vivo | Prolactin Releasing Peptide (1-31), human (acetate), administered intracerebroventricularly (ICV) at 5 nM, enhances plasma follicle-stimulating hormone (FSH), elevates total plasma testosterone levels, and significantly augments luteinizing hormone-releasing hormone (LHRH) release from in vitro hypothalamic explants [2]. At 100 nM ICV, it upregulates hypothalamic peptides regulating pituitary hormone secretion, specifically vasoactive intestinal peptide (VIP) and galanin, without affecting orexin A secretion [2]. |
| Molecular Weight | 3724.17 |
| Formula | C162H26N56O44S |
| Sequence | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Sequence Short | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.