Shopping Cart
Remove All
Your shopping cart is currently empty
Prolactin Releasing Peptide (1-31), human acetate
Copy Product Info
😃Good
Catalog No. T78006
Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2].
Prolactin Releasing Peptide (1-31), human acetate
Prolactin Releasing Peptide (1-31), human acetate
Copy Product Info😃Good
Catalog No. T78006
Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2]. |
| In vitro | Prolactin Releasing Peptide (1-31), human (acetate), shows high affinity for the GPR10 receptor in humans and rats, with Ki values of 1.03 nM and 0.33 nM, respectively [1]. |
| In vivo | Prolactin Releasing Peptide (1-31), human (acetate), administered intracerebroventricularly (ICV) at 5 nM, enhances plasma follicle-stimulating hormone (FSH), elevates total plasma testosterone levels, and significantly augments luteinizing hormone-releasing hormone (LHRH) release from in vitro hypothalamic explants [2]. At 100 nM ICV, it upregulates hypothalamic peptides regulating pituitary hormone secretion, specifically vasoactive intestinal peptide (VIP) and galanin, without affecting orexin A secretion [2]. |
| Molecular Weight | 3724.17 |
| Formula | C162H26N56O44S |
| Sequence | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Sequence Short | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Stock Solution Preparation:
Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
Preparation of the In Vivo Formulation:
1) Add 100 μL of the DMSO stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy Prolactin Releasing Peptide (1-31), human acetate | purchase Prolactin Releasing Peptide (1-31), human acetate | Prolactin Releasing Peptide (1-31), human acetate cost | order Prolactin Releasing Peptide (1-31), human acetate | Prolactin Releasing Peptide (1-31), human acetate in vivo | Prolactin Releasing Peptide (1-31), human acetate in vitro | Prolactin Releasing Peptide (1-31), human acetate formula | Prolactin Releasing Peptide (1-31), human acetate molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.