Your shopping cart is currently empty

Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Prolactin Releasing Peptide (1-31), human (acetate), is a potent GPR10 ligand with high affinity, eliciting prolactin secretion. It binds to human and rat GPR10 with K_i values of 1.03 nM and 0.33 nM, respectively, and serves as a tool for researching the hypothalamo-pituitary axis [1] [2]. |
| In vitro | Prolactin Releasing Peptide (1-31), human (acetate), shows high affinity for the GPR10 receptor in humans and rats, with Ki values of 1.03 nM and 0.33 nM, respectively [1]. |
| In vivo | Prolactin Releasing Peptide (1-31), human (acetate), administered intracerebroventricularly (ICV) at 5 nM, enhances plasma follicle-stimulating hormone (FSH), elevates total plasma testosterone levels, and significantly augments luteinizing hormone-releasing hormone (LHRH) release from in vitro hypothalamic explants [2]. At 100 nM ICV, it upregulates hypothalamic peptides regulating pituitary hormone secretion, specifically vasoactive intestinal peptide (VIP) and galanin, without affecting orexin A secretion [2]. |
| Molecular Weight | 3724.17 |
| Formula | C162H26N56O44S |
| Sequence | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Sequence Short | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.