Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Glycine-rich RNA-binding protein CIRP, Cold-inducible RNA-binding protein, Cirp, Cirbp, A18 hnRNP

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P60824 |
| Amino Acid | MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE |
| Construction | 1-172 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Glycine-rich RNA-binding protein CIRP, Cold-inducible RNA-binding protein, Cirp, Cirbp, A18 hnRNP |
| Research Background | Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. |
| Molecular Weight | 22.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.