MAPK1IP1L Protein, Human, Recombinant (hFc)

Name: MAPK1IP1L Protein, Human, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-01639
Rating: 4.5 (1 reviews)

(Synonyms: Mitogen-activated protein kinase 1-interacting protein 1-like, MAPK-interacting and spindle-stabilizing protein-like, MAPK1IP1L, C14orf32) Copy Product Info

Synonyms: Mitogen-activated protein kinase 1-interacting protein 1-like, MAPK-interacting and spindle-stabilizing protein-like, MAPK1IP1L, C14orf32

Catalog No. TMPH-01639 Copy Product Info

MAPK1IP1L Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 53.1 kDa and the accession number is Q8NDC0.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$219	20 days	20 days
10 µg	$365	20 days	20 days
20 µg	$613	20 days	20 days
50 µg	$1,160	20 days	20 days
100 µg	$1,890	20 days	20 days
200 µg	$2,890	20 days	20 days
500 µg	$5,160	20 days	20 days
1 mg	$7,960	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	MAPK1IP1L Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 53.1 kDa and the accession number is Q8NDC0.
Species	Human
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q8NDC0
Amino Acid	SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH
Construction	2-245 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Mitogen-activated protein kinase 1-interacting protein 1-like, MAPK-interacting and spindle-stabilizing protein-like, MAPK1IP1L, C14orf32
Research Background	N/A

Chemical Properties

Molecular Weight

53.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.