ADTRP Protein, Human, Recombinant (His & Myc)

Name: ADTRP Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-00933
Rating: 4.5 (1 reviews)

(Synonyms: Fatty acid esters of hydroxy fatty acids hydrolase ADTRP (FAHFA hydrolase ADTRP), C6orf105, Androgen-dependent TFPI-regulating protein, ADTRP) Copy Product Info

Synonyms: Fatty acid esters of hydroxy fatty acids hydrolase ADTRP (FAHFA hydrolase ADTRP), C6orf105, Androgen-dependent TFPI-regulating protein, ADTRP

Catalog No. TMPH-00933 Copy Product Info

ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$526	20 days	20 days
10 µg	$886	20 days	20 days
20 µg	$1,500	20 days	20 days
50 µg	$2,090	20 days	20 days
100 µg	$2,750	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.
Species	Human
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q96IZ2
Amino Acid	MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Construction	1-230 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Fatty acid esters of hydroxy fatty acids hydrolase ADTRP (FAHFA hydrolase ADTRP), C6orf105, Androgen-dependent TFPI-regulating protein, ADTRP
Research Background	Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Chemical Properties

Molecular Weight

31.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.