Shopping Cart
Remove All
Your shopping cart is currently empty
ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $526 | 20 days | 20 days | |
| 10 μg | $886 | 20 days | 20 days | |
| 20 μg | $1,500 | 20 days | 20 days | |
| 50 μg | $2,090 | 20 days | 20 days | |
| 100 μg | $2,750 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q96IZ2 |
| Synonyms | Fatty acid esters of hydroxy fatty acids hydrolase ADTRP (FAHFA hydrolase ADTRP),C6orf105,Androgen-dependent TFPI-regulating protein,ADTRP |
| Amino Acid | MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK |
| Construction | 1-230 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 31.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro). |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.