CXCL1 Protein, Human, Recombinant (Active)

Name: CXCL1 Protein, Human, Recombinant (Active)
Brand: TargetMol
SKU: TMPH-03951
Price: 147 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: SCYB1, Neutrophil-activating protein 3 (NAP-3), MGSA, Melanoma growth stimulatory activity (MGSA), Growth-regulated alpha protein, GRO-alpha(1-73), GROA, GRO1, GRO, CXCL1, C-X-C motif chemokine 1) Copy Product Info

Synonyms: SCYB1, Neutrophil-activating protein 3 (NAP-3), MGSA, Melanoma growth stimulatory activity (MGSA), Growth-regulated alpha protein, GRO-alpha(1-73), GROA, GRO1, GRO, CXCL1, C-X-C motif chemokine 1

Catalog No. TMPH-03951 Copy Product Info

CXCL1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P09341.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	-	In Stock
10 µg	$223	-	In Stock
20 µg	$382	-	In Stock
50 µg	$739	7-10 days	7-10 days
100 µg	$1,220	7-10 days	7-10 days
200 µg	$1,720	7-10 days	7-10 days
500 µg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:>95% as determined by SDS-PAGE and HPLC

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-50 ng/ml.
Description	CXCL1 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P09341.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P09341
Amino Acid	ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Construction	35-107 aa
Protein Purity	>97% as determined by SDS-PAGE and HPLC
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	SCYB1, Neutrophil-activating protein 3 (NAP-3), MGSA, Melanoma growth stimulatory activity (MGSA), Growth-regulated alpha protein, GRO-alpha(1-73), GROA, GRO1, GRO, CXCL1, C-X-C motif chemokine 1

Chemical Properties

Molecular Weight

7.9 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.