Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03645

Inactivates eukaryotic 60S ribosomal subunits. Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 30.8 kDa and the accession number is P09989.

Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)

Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03645
Inactivates eukaryotic 60S ribosomal subunits. Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 30.8 kDa and the accession number is P09989.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$360-In Stock
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Inactivates eukaryotic 60S ribosomal subunits. Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 30.8 kDa and the accession number is P09989.
Species
Trichosanthes kirilowii
Expression System
E. coli
TagN-10xHis
Accession NumberP09989
Synonyms
rRNA N-glycosidase,Ribosome-inactivating protein alpha-trichosanthin,Alpha-TCS
Amino Acid
DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Construction
24-270 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)
Molecular Weight30.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Inactivates eukaryotic 60S ribosomal subunits.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords