Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)

Catalog No. TMPH-03645

Inactivates eukaryotic 60S ribosomal subunits. Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 30.8 kDa and the accession number is P09989.

Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)

Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His)

Catalog No. TMPH-03645
Inactivates eukaryotic 60S ribosomal subunits. Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 30.8 kDa and the accession number is P09989.
Pack SizePriceAvailabilityQuantity
20 μg$360In Stock
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Inactivates eukaryotic 60S ribosomal subunits. Alpha-TCS Protein, Trichosanthes kirilowii, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 30.8 kDa and the accession number is P09989.
Species
Trichosanthes kirilowii
Expression System
E. coli
TagN-10xHis
Accession NumberP09989
Synonyms
rRNA N-glycosidase,Ribosome-inactivating protein alpha-trichosanthin,Alpha-TCS
Amino Acid
DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Construction
24-270 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight30.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Inactivates eukaryotic 60S ribosomal subunits.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords