Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

PBP1a Protein, Clostridium botulinum, Recombinant (His & SUMO)

Catalog No. TMPH-00407

PBP1a Protein, Clostridium botulinum, Recombinant (His & SUMO) is expressed in E. coli.

PBP1a Protein, Clostridium botulinum, Recombinant (His & SUMO)

PBP1a Protein, Clostridium botulinum, Recombinant (His & SUMO)

Catalog No. TMPH-00407
PBP1a Protein, Clostridium botulinum, Recombinant (His & SUMO) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PBP1a Protein, Clostridium botulinum, Recombinant (His & SUMO) is expressed in E. coli.
Species
Clostridium botulinum
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberA5I6G4
Synonyms
Penicillin-binding protein 1A,pbpA,PBP1a
Amino Acid
VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
Construction
663-830 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight35.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.