mTOR Protein, Human, Recombinant (His)

Catalog No. TMPH-04811

mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.

mTOR Protein, Human, Recombinant (His)

Catalog No. TMPH-04811

mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.

Pack Size	Price	USA Warehouse	Global Warehouse
20 μg	Inquiry	Backorder	Backorder
50 μg	Inquiry	Backorder	Backorder
100 μg	Inquiry	Backorder	Backorder

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	P42345
Synonyms	Serine/threonine-protein kinase mTOR,RAPT1,Rapamycin and FKBP12 target 1,RAFT1,MTOR,Mechanistic target of rapamycin,Mammalian target of rapamycin (mTOR),FRAP2,FRAP1,FRAP,FKBP12-rapamycin complex-associated protein,FK506-binding protein 12-rapamycin complex-associated protein 1
Amino Acid	VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTY
Construction	2012-2144 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	<1.0 EU per 1μg of the protein by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice.