mTOR Protein, Human, Recombinant (His)

Name: mTOR Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04811
Rating: 4.5 (1 reviews)

(Synonyms: Serine/threonine-protein kinase mTOR, RAPT1, Rapamycin and FKBP12 target 1, RAFT1, MTOR, Mechanistic target of rapamycin, Mammalian target of rapamycin (mTOR), FRAP2, FRAP1, FRAP, FKBP12-rapamycin complex-associated protein, FK506-binding protein 12-rapamycin complex-associated protein 1) Copy Product Info

Synonyms: Serine/threonine-protein kinase mTOR, RAPT1, Rapamycin and FKBP12 target 1, RAFT1, MTOR, Mechanistic target of rapamycin, Mammalian target of rapamycin (mTOR), FRAP2, FRAP1, FRAP, FKBP12-rapamycin complex-associated protein, FK506-binding protein 12-rapamycin complex-associated protein 1

Catalog No. TMPH-04811 Copy Product Info

Purity: 95%

mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.

Pack Size	Price	USA Stock	Global Stock
20 µg	Inquiry	Inquiry	Inquiry
50 µg	Inquiry	Inquiry	Inquiry
100 µg	Inquiry	Inquiry	Inquiry

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:95%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	P42345
Amino Acid	VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTY
Construction	2012-2144 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Serine/threonine-protein kinase mTOR, RAPT1, Rapamycin and FKBP12 target 1, RAFT1, MTOR, Mechanistic target of rapamycin, Mammalian target of rapamycin (mTOR), FRAP2, FRAP1, FRAP, FKBP12-rapamycin complex-associated protein, FK506-binding protein 12-rapamycin complex-associated protein 1

Chemical Properties

Molecular Weight	22.7 kDa (predicted)
Relative Density.	no data available

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.