Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

mTOR Protein, Human, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04811

mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.

mTOR Protein, Human, Recombinant (His)

mTOR Protein, Human, Recombinant (His)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04811
mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
20 μgInquiryInquiryInquiry
50 μgInquiryInquiryInquiry
100 μgInquiryInquiryInquiry
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
mTOR Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P42345.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberP42345
Synonyms
Serine/threonine-protein kinase mTOR,RAPT1,Rapamycin and FKBP12 target 1,RAFT1,MTOR,Mechanistic target of rapamycin,Mammalian target of rapamycin (mTOR),FRAP2,FRAP1,FRAP,FKBP12-rapamycin complex-associated protein,FK506-binding protein 12-rapamycin complex-associated protein 1
Amino Acid
VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTY
Construction
2012-2144 aa
Protein Purity
> 85% as determined by SDS-PAGE.
mTOR Protein, Human, Recombinant (His)
Molecular Weight22.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords