Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

REG3G Protein, Mouse, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04326 Copy Product Info
REG3G Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O09049.

REG3G Protein, Mouse, Recombinant

Catalog No. TMPH-04326
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

REG3G Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O09049.

REG3G Protein, Mouse, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$15820 days20 days
10 μg$26220 days20 days
20 μg$43920 days20 days
50 μg$56920 days20 days
100 μg$69220 days20 days
200 μg$98720 days20 days
500 μg$1,67020 days20 days
1 mg$2,45020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
REG3G Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O09049.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberO09049
Synonyms
Regenerating islet-derived protein III-gamma (Reg III-gamma),Regenerating islet-derived protein 3-gamma,REG-3-gamma,Reg3g,Pap3,Pancreatitis-associated protein 3
Amino Acid
EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Construction
27-174 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight16.5 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords