Shopping Cart
- Remove All
 
Your shopping cart is currently empty
REG3G Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O09049.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $158 | 20 days | |
| 10 μg | $262 | 20 days | |
| 20 μg | $439 | 20 days | |
| 50 μg | $569 | 20 days | |
| 100 μg | $692 | 20 days | |
| 200 μg | $987 | 20 days | |
| 500 μg | $1,670 | 20 days | |
| 1 mg | $2,450 | 20 days | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it.  | 
| Description | REG3G Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O09049.  | 
| Species | Mouse  | 
| Expression System | E. coli  | 
| Tag | Tag Free | 
| Accession Number | O09049 | 
| Synonyms | Regenerating islet-derived protein III-gamma (Reg III-gamma),Regenerating islet-derived protein 3-gamma,REG-3-gamma,Reg3g,Pap3,Pancreatitis-associated protein 3  | 
| Amino Acid | EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA  | 
| Construction | 27-174 aa  | 
| Protein Purity | >85% as determined by SDS-PAGE.  | 
| Molecular Weight | 16.5 kDa (Predicted) | 
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. | 
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.  | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.  | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.