Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

NUP210 Protein, Human, Recombinant (His)

Catalog No. TMPH-01790

Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.

NUP210 Protein, Human, Recombinant (His)

NUP210 Protein, Human, Recombinant (His)

Catalog No. TMPH-01790
Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.
Pack SizePriceAvailabilityQuantity
20 μg$19820 days
100 μg$42720 days
1 mg$1,83020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberQ8TEM1
Synonyms
Pore membrane protein of 210 kDa,NUP210,Nucleoporin Nup210,Nuclear pore protein gp210,Nuclear pore membrane glycoprotein 210,Nuclear envelope pore membrane protein POM 210 (POM210),KIAA0906
Amino Acid
AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Construction
1529-1808 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight34.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords