NUP210 Protein, Human, Recombinant (His)

Name: NUP210 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01790
Rating: 4.5 (1 reviews)

(Synonyms: Pore membrane protein of 210 kDa, NUP210, Nucleoporin Nup210, Nuclear pore protein gp210, Nuclear pore membrane glycoprotein 210, Nuclear envelope pore membrane protein POM 210 (POM210), KIAA0906) Copy Product Info

Synonyms: Pore membrane protein of 210 kDa, NUP210, Nucleoporin Nup210, Nuclear pore protein gp210, Nuclear pore membrane glycoprotein 210, Nuclear envelope pore membrane protein POM 210 (POM210), KIAA0906

Catalog No. TMPH-01790 Copy Product Info

Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.

NUP210 Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q8TEM1
Amino Acid	AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Construction	1529-1808 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Pore membrane protein of 210 kDa, NUP210, Nucleoporin Nup210, Nuclear pore protein gp210, Nuclear pore membrane glycoprotein 210, Nuclear envelope pore membrane protein POM 210 (POM210), KIAA0906
Research Background	Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.

Chemical Properties

Molecular Weight

34.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.