Shopping Cart
- Remove All
- Your shopping cart is currently empty
Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $198 | 20 days | |
100 μg | $427 | 20 days | |
1 mg | $1,830 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1. |
Species | Human |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q8TEM1 |
Synonyms | Pore membrane protein of 210 kDa,NUP210,Nucleoporin Nup210,Nuclear pore protein gp210,Nuclear pore membrane glycoprotein 210,Nuclear envelope pore membrane protein POM 210 (POM210),KIAA0906 |
Amino Acid | AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ |
Construction | 1529-1808 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 34.5 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.