Shopping Cart
- Remove All
- Your shopping cart is currently empty
EGLN1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9GZT9.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $116 | 20 days | |
10 μg | $189 | 20 days | |
20 μg | $317 | 20 days | |
50 μg | $448 | 20 days | |
100 μg | $588 | 20 days | |
200 μg | $913 | 20 days | |
500 μg | $1,630 | 20 days | |
1 mg | $2,550 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | EGLN1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9GZT9. |
Species | Human |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q9GZT9 |
Synonyms | SM-20,Prolyl hydroxylase domain-containing protein 2 (PHD2),Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2;HIF-prolyl hydroxylase 2;HPH-2),EGLN1,Egl nine homolog 1,C1orf12 |
Amino Acid | GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF |
Construction | 177-426 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 31.9 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 293 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.