Shopping Cart
Remove All
Your shopping cart is currently empty
Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $588 | 20 days | 20 days | |
| 10 μg | $992 | 20 days | 20 days | |
| 20 μg | $1,680 | 20 days | 20 days | |
| 50 μg | $2,230 | 20 days | 20 days | |
| 100 μg | $2,800 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7. |
| Species | Dictyostelium discoideum |
| Expression System | in vitro E. coli expression system |
| Tag | N-10xHis |
| Accession Number | Q54VH7 |
| Synonyms | Zinc finger DHHC domain-containing protein 8,Putative ZDHHC-type palmitoyltransferase 8 |
| Amino Acid | MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLWYTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVNLYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGKWSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSFFPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASFGILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYNLIIPYYKRKINKLNK |
| Construction | 1-375 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 49.9 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 386 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.