Shopping Cart
Remove All
Your shopping cart is currently empty
Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His)
(Synonyms: Zinc finger DHHC domain-containing protein 8, Putative ZDHHC-type palmitoyltransferase 8) Copy Product InfoSynonyms: Zinc finger DHHC domain-containing protein 8, Putative ZDHHC-type palmitoyltransferase 8
Catalog No. TMPH-04749 Copy Product Info
Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $588 | 20 days | 20 days | |
| 10 µg | $992 | 20 days | 20 days | |
| 20 µg | $1,680 | 20 days | 20 days | |
| 50 µg | $2,230 | 20 days | 20 days | |
| 100 µg | $2,800 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7. |
| Species | Dictyostelium discoideum |
| Expression System | in vitro E. coli expression system |
| Tag | N-10xHis |
| Accession Number | Q54VH7 |
| Amino Acid | MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLWYTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVNLYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGKWSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSFFPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASFGILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYNLIIPYYKRKINKLNK |
| Construction | 1-375 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Zinc finger DHHC domain-containing protein 8, Putative ZDHHC-type palmitoyltransferase 8 |
| Molecular Weight | 49.9 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 386 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) chemical structure | Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.