Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His)

Catalog No. TMPH-04749

Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7.

Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His)

Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His)

Catalog No. TMPH-04749
Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7.
Pack SizePriceAvailabilityQuantity
20 μg$1,68020 days
100 μg$2,80020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Putative ZDHHC-type palmitoyltransferase 8 Protein, D. discoideum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q54VH7.
Species
Dictyostelium discoideum
Expression System
in vitro E. coli expression system
TagN-10xHis
Accession NumberQ54VH7
Synonyms
Zinc finger DHHC domain-containing protein 8,Putative ZDHHC-type palmitoyltransferase 8
Amino Acid
MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLWYTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVNLYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGKWSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSFFPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASFGILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYNLIIPYYKRKINKLNK
Construction
1-375 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight49.9 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 386 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.