DHH Protein, Human, Recombinant

Catalog No. TMPH-03888

DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.

DHH Protein, Human, Recombinant

Catalog No. TMPH-03888

DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.

Pack Size	Price	Availability
5 μg	$130	20 days
10 μg	$198	20 days
20 μg	$327	20 days
50 μg	$597	20 days
100 μg	$987	20 days
200 μg	$1,390	20 days
500 μg	$2,270	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml.
Description	DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	O43323
Synonyms	HHG-3,DHH,Desert hedgehog protein
Amino Acid	II+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Construction	24-198 aa
Protein Purity	>96% as determined by SDS-PAGE.
Molecular Weight	19.9 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.