Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DHH Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03888 Copy Product Info
DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.

DHH Protein, Human, Recombinant

Catalog No. TMPH-03888
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.

DHH Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13020 days20 days
10 μg$19820 days20 days
20 μg$32720 days20 days
50 μg$59720 days20 days
100 μg$98720 days20 days
200 μg$1,39020 days20 days
500 μg$2,27020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml.
Description
DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberO43323
Synonyms
HHG-3,DHH,Desert hedgehog protein
Amino Acid
II+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Construction
24-198 aa
Protein Purity
>96% as determined by SDS-PAGE.
Molecular Weight19.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords