Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DHH Protein, Human, Recombinant

(Synonyms: HHG-3, DHH, Desert hedgehog protein) Copy Product Info

Synonyms: HHG-3, DHH, Desert hedgehog protein

Catalog No. TMPH-03888 Copy Product Info
DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.
DHH Protein, Human, Recombinant
TargetMol | Customer service
Customer service consultation
Pack SizePriceUSA StockGlobal StockQuantity
5 µg$13020 days20 days
10 µg$19820 days20 days
20 µg$32720 days20 days
50 µg$59720 days20 days
100 µg$98720 days20 days
200 µg$1,39020 days20 days
500 µg$2,27020 days20 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml.
Description
DHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O43323.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberO43323
Amino AcidII+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Construction24-198 aa
Protein Purity
>96% as determined by SDS-PAGE.
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl
ReconstitutionReconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
SynonymsHHG-3, DHH, Desert hedgehog protein
Chemical Properties
Molecular Weight19.9 kDa (Predicted)
Storage & Solubility Information
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
StorageLyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Keywords

Related Tags: DHH Protein, Human, Recombinant chemical structure | DHH Protein, Human, Recombinant molecular weight