Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc)

Catalog No. TMPH-03677

Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P21081.

Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc)

Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc)

Catalog No. TMPH-03677
Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P21081.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$74520 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P21081.
Species
VACV
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP21081
Synonyms
RNA-binding protein OPG065,RNA-binding protein E3,p25,OPG065
Amino Acid
MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF
Construction
1-190 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight28.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays a role in the inhibition of multiple cellular antiviral responses activated by dsRNA, such as inhibition of PKR activation, apoptosis, and IFN-mediated antiviral activities. Blocks also the phosphorylation and subsequent activation of IRF3 and IRF7 kinases that are required for interferon-alpha gene expression. Inhibits NF-kappa-B activation and the ubiquitin-like protein ISG15, which is an early antiviral protein. The binding with host ISG15 subsequently blocks host ISGylation. Inhibits ZBP1-dependent necroptosis via interaction with host ZBP1.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords