Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc)

Name: Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc)
Brand: TargetMol
SKU: TMPH-03677
Rating: 4.5 (1 reviews)

(Synonyms: RNA-binding protein OPG065, RNA-binding protein E3, p25, OPG065) Copy Product Info

Synonyms: RNA-binding protein OPG065, RNA-binding protein E3, p25, OPG065

Catalog No. TMPH-03677 Copy Product Info

Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P21081.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P21081.
Species	VACV
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P21081
Amino Acid	MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF
Construction	1-190 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	RNA-binding protein OPG065, RNA-binding protein E3, p25, OPG065
Research Background	Plays a role in the inhibition of multiple cellular antiviral responses activated by dsRNA, such as inhibition of PKR activation, apoptosis, and IFN-mediated antiviral activities. Blocks also the phosphorylation and subsequent activation of IRF3 and IRF7 kinases that are required for interferon-alpha gene expression. Inhibits NF-kappa-B activation and the ubiquitin-like protein ISG15, which is an early antiviral protein. The binding with host ISG15 subsequently blocks host ISGylation. Inhibits ZBP1-dependent necroptosis via interaction with host ZBP1.

Chemical Properties

Molecular Weight

28.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

p 25OPG 065

Related Tags: Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) chemical structure | Vaccinia virus (strain Copenhagen) OPG065 Protein (His & Myc) molecular weight