Shopping Cart
Remove All
Your shopping cart is currently empty
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $130 | 20 days | 20 days | |
| 10 μg | $219 | 20 days | 20 days | |
| 20 μg | $378 | 20 days | 20 days | |
| 50 μg | $788 | 20 days | 20 days | |
| 100 μg | $1,380 | 20 days | 20 days | |
| 200 μg | $1,970 | 20 days | 20 days | |
| 500 μg | $3,170 | 20 days | 20 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inhibiting BMP-4- induced alkaline phosphatase production of murine ATDC5 cells is less than 3.0 ng/ml, corresponding to a specific activity of > 3.3 × 105 IU/mg in the presence of 5 ng/ml rHuBMP-4. |
| Description | Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q13253 |
| Synonyms | Noggin,NOG |
| Amino Acid | M+QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Construction | M+28-232 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 23.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 30 % acetonitrile, 0.1 % TFA |
| Reconstitution | Reconstitute the lyophilized protein in 10 mM HCl. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.