Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Noggin/NOG Protein, Human, Recombinant (E. coli)

Catalog No. TMPH-04040 Copy Product Info
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.

Noggin/NOG Protein, Human, Recombinant (E. coli)

Catalog No. TMPH-04040
Copy Product Info

Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.

Noggin/NOG Protein, Human, Recombinant (E. coli)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13020 days20 days
10 μg$21920 days20 days
20 μg$37820 days20 days
50 μg$78820 days20 days
100 μg$1,38020 days20 days
200 μg$1,97020 days20 days
500 μg$3,17020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by inhibiting BMP-4- induced alkaline phosphatase production of murine ATDC5 cells is less than 3.0 ng/ml, corresponding to a specific activity of > 3.3 × 105 IU/mg in the presence of 5 ng/ml rHuBMP-4.
Description
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ13253
Synonyms
Noggin,NOG
Amino Acid
M+QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Construction
M+28-232 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight23.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 30 % acetonitrile, 0.1 % TFA
Reconstitution
Reconstitute the lyophilized protein in 10 mM HCl. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.