Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Noggin/NOG Protein, Human, Recombinant (E. coli)

(Synonyms: Noggin, NOG) Copy Product Info

Synonyms: Noggin, NOG

Catalog No. TMPH-04040 Copy Product Info
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.
Noggin/NOG Protein, Human, Recombinant (E. coli)
TargetMol | Customer service
Customer service consultation
Pack SizePriceUSA StockGlobal StockQuantity
5 µg$13020 days20 days
10 µg$21920 days20 days
20 µg$37820 days20 days
50 µg$78820 days20 days
100 µg$1,38020 days20 days
200 µg$1,97020 days20 days
500 µg$3,17020 days20 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by inhibiting BMP-4- induced alkaline phosphatase production of murine ATDC5 cells is less than 3.0 ng/ml, corresponding to a specific activity of > 3.3 × 105 IU/mg in the presence of 5 ng/ml rHuBMP-4.
Description
Noggin/NOG Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is Q13253.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ13253
Amino AcidM+QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
ConstructionM+28-232 aa
Protein Purity
>95% as determined by SDS-PAGE.
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 30 % acetonitrile, 0.1 % TFA
ReconstitutionReconstitute the lyophilized protein in 10 mM HCl. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
SynonymsNoggin, NOG
Chemical Properties
Molecular Weight23.2 kDa (Predicted)
Storage & Solubility Information
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
StorageLyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Related Tags: Noggin/NOG Protein, Human, Recombinant (E. coli) chemical structure | Noggin/NOG Protein, Human, Recombinant (E. coli) molecular weight