CCR9-VLP Protein, Human, Recombinant (His)

Name: CCR9-VLP Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03837
Rating: 4.5 (1 reviews)

(Synonyms: G-protein coupled receptor 28, GPR-9-6, GPR28, CDw199, CCR-9, CCR9, CC-CKR-9, C-C CKR-9, C-C chemokine receptor type 9) Copy Product Info

Synonyms: G-protein coupled receptor 28, GPR-9-6, GPR28, CDw199, CCR-9, CCR9, CC-CKR-9, C-C CKR-9, C-C chemokine receptor type 9

Catalog No. TMPH-03837 Copy Product Info

CCR9-VLP Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P51686.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$289	20 days	20 days
10 µg	$483	20 days	20 days
20 µg	$815	20 days	20 days
50 µg	$1,270	20 days	20 days
100 µg	$1,790	20 days	20 days
200 µg	$2,990	20 days	20 days
500 µg	$5,890	20 days	20 days
1 mg	$9,870	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU). The EC50 is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control.
Description	CCR9-VLP Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis (This tag can be tested only under denaturing conditions). The accession number is P51686.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis (This tag can be tested only under denaturing conditions)
Accession Number	P51686
Amino Acid	MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Construction	1-369 aa
Protein Purity	>95% as determined by SEC-HPLC.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	G-protein coupled receptor 28, GPR-9-6, GPR28, CDw199, CCR-9, CCR9, CC-CKR-9, C-C CKR-9, C-C chemokine receptor type 9

Chemical Properties

Molecular Weight

43.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.