CYBB Protein, Human, Recombinant (His)

Name: CYBB Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03751
Rating: 4.5 (1 reviews)

(Synonyms: Superoxide-generating NADPH oxidase heavy chain subunit, p22 phagocyte B-cytochrome, NOX2, Neutrophil cytochrome b 91 kDa polypeptide, NADPH oxidase 2, Heme-binding membrane glycoprotein gp91phox, gp91-phox, gp91-1, Cytochrome b-245 heavy chain, Cytochrome b(558) subunit beta (Cytochrome b558 subunit beta), CYBB, CGD91-phox) Copy Product Info

Synonyms: Superoxide-generating NADPH oxidase heavy chain subunit, p22 phagocyte B-cytochrome, NOX2, Neutrophil cytochrome b 91 kDa polypeptide, NADPH oxidase 2, Heme-binding membrane glycoprotein gp91phox, gp91-phox, gp91-1, Cytochrome b-245 heavy chain, Cytochrome b(558) subunit beta (Cytochrome b558 subunit beta), CYBB, CGD91-phox

Catalog No. TMPH-03751 Copy Product Info

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:92%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	P04839
Amino Acid	ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Construction	283-570 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Superoxide-generating NADPH oxidase heavy chain subunit, p22 phagocyte B-cytochrome, NOX2, Neutrophil cytochrome b 91 kDa polypeptide, NADPH oxidase 2, Heme-binding membrane glycoprotein gp91phox, gp91-phox, gp91-1, Cytochrome b-245 heavy chain, Cytochrome b(558) subunit beta (Cytochrome b558 subunit beta), CYBB, CGD91-phox
Research Background	Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.

Chemical Properties

Molecular Weight

37.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.