ARID1A Protein, Human, Recombinant (His & Myc)

Name: ARID1A Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-00987
Rating: 4.5 (1 reviews)

(Synonyms: SWI-like protein, SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1, SWI/SNF complex protein p270, SMARCF1, OSA1, Osa homolog 1 (hOSA1), hELD, C1orf4, BRG1-associated factor 250a (BAF250A), BRG1-associated factor 250 (BAF250), BAF250A, BAF250, B120, AT-rich interactive domain-containing protein 1A, ARID1A, ARID domain-containing protein 1A) Copy Product Info

Synonyms: SWI-like protein, SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1, SWI/SNF complex protein p270, SMARCF1, OSA1, Osa homolog 1 (hOSA1), hELD, C1orf4, BRG1-associated factor 250a (BAF250A), BRG1-associated factor 250 (BAF250), BAF250A, BAF250, B120, AT-rich interactive domain-containing protein 1A, ARID1A, ARID domain-containing protein 1A

Catalog No. TMPH-00987 Copy Product Info

ARID1A Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 32.4 kDa and the accession number is O14497.

Pack Size	Price	USA Stock	Global Stock
5 µg	$176	20 days	20 days
10 µg	$292	20 days	20 days
20 µg	$489	20 days	20 days
50 µg	$923	20 days	20 days
100 µg	$1,500	20 days	20 days
200 µg	$1,890	20 days	20 days
500 µg	$2,580	20 days	20 days
1 mg	$3,260	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ARID1A Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 32.4 kDa and the accession number is O14497.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	O14497
Amino Acid	SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Construction	1976-2231 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	SWI-like protein, SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1, SWI/SNF complex protein p270, SMARCF1, OSA1, Osa homolog 1 (hOSA1), hELD, C1orf4, BRG1-associated factor 250a (BAF250A), BRG1-associated factor 250 (BAF250), BAF250A, BAF250, B120, AT-rich interactive domain-containing protein 1A, ARID1A, ARID domain-containing protein 1A
Research Background	Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

Chemical Properties

Molecular Weight

32.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.