CXCR3 Protein, Human, Recombinant (GST & His)

Catalog No. TMPH-01162 Copy Product Info

CXCR3 Protein, Human, Recombinant (GST & His) is expressed in E. coli.

CXCR3 Protein, Human, Recombinant (GST & His)

Catalog No. TMPH-01162

Copy Product Info

CXCR3 Protein, Human, Recombinant (GST & His) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CXCR3 Protein, Human, Recombinant (GST & His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis-GST
Accession Number	P49682
Synonyms	Interferon-inducible protein 10 receptor (IP-10 receptor),GPR9,G protein-coupled receptor 9,CXCR-3,CXC-R3,CXCR3,C-X-C chemokine receptor type 3,CKR-L2,CD183
Amino Acid	EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Construction	4-50 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	36.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.; Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.; Mediates the activity of CXCL11.