CXCR3 Protein, Human, Recombinant (GST & His)

Name: CXCR3 Protein, Human, Recombinant (GST & His)
Brand: TargetMol
SKU: TMPH-01162
Rating: 4.5 (1 reviews)

(Synonyms: Interferon-inducible protein 10 receptor (IP-10 receptor), GPR9, G protein-coupled receptor 9, CXCR-3, CXC-R3, CXCR3, C-X-C chemokine receptor type 3, CKR-L2, CD183) Copy Product Info

Synonyms: Interferon-inducible protein 10 receptor (IP-10 receptor), GPR9, G protein-coupled receptor 9, CXCR-3, CXC-R3, CXCR3, C-X-C chemokine receptor type 3, CKR-L2, CD183

Catalog No. TMPH-01162 Copy Product Info

CXCR3 Protein, Human, Recombinant (GST & His) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CXCR3 Protein, Human, Recombinant (GST & His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis-GST
Accession Number	P49682
Amino Acid	EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Construction	4-50 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Interferon-inducible protein 10 receptor (IP-10 receptor), GPR9, G protein-coupled receptor 9, CXCR-3, CXC-R3, CXCR3, C-X-C chemokine receptor type 3, CKR-L2, CD183
Research Background	Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.; Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.; Mediates the activity of CXCL11.

Chemical Properties

Molecular Weight

36.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.