Adiponectin Protein, Bovine, Recombinant (His)

Catalog No. TMPH-00219 Copy Product Info

Adiponectin Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.4 kDa and the accession number is Q3Y5Z3.

Adiponectin Protein, Bovine, Recombinant (His)

Catalog No. TMPH-00219

Copy Product Info

Adiponectin Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.4 kDa and the accession number is Q3Y5Z3.

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Adiponectin Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.4 kDa and the accession number is Q3Y5Z3.
Species	Bovine
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q3Y5Z3
Synonyms	APM1,Adipose most abundant gene transcript 1 protein (apM-1),ADIPOQ,Adiponectin,Adipocyte, C1q and collagen domain-containing protein,Adipocyte complement-related 30 kDa protein (ACRP30),ACRP30,30 kDa adipocyte complement-related protein
Amino Acid	EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Construction	18-240 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	26.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.