Shopping Cart
Remove All
Your shopping cart is currently empty
IHH Protein, Human, Recombinant (C28II)
(Synonyms: Indian hedgehog protein, IHH, HHG-2) Copy Product InfoSynonyms: Indian hedgehog protein, IHH, HHG-2
Catalog No. TMPH-03973 Copy Product Info
IHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q14623.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $147 | 7-10 days | 7-10 days | |
| 10 μg | $246 | 7-10 days | 7-10 days | |
| 20 μg | $416 | 7-10 days | 7-10 days | |
| 50 μg | $853 | 7-10 days | 7-10 days | |
| 100 μg | $1,460 | 7-10 days | 7-10 days | |
| 200 μg | $1,980 | 7-10 days | 7-10 days | |
| 500 μg | $3,300 | 7-10 days | 7-10 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | IHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q14623. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q14623 |
| Amino Acid | II+GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG |
| Construction | 28-202 aa |
| Protein Purity | >96% as determined by SDS-PAGE and HPLC |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 1 × PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Indian hedgehog protein, IHH, HHG-2 |
| Molecular Weight | 19.8 kDa (Predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: IHH Protein, Human, Recombinant (C28II) chemical structure | IHH Protein, Human, Recombinant (C28II) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.