Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IHH Protein, Human, Recombinant (C28II)

TargetMol | SPR
Catalog No. TMPH-03973 Copy Product Info
IHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q14623.

IHH Protein, Human, Recombinant (C28II)

Catalog No. TMPH-03973
Copy Product Info
TargetMol | SPR

IHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q14623.

IHH Protein, Human, Recombinant (C28II)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$1477-10 days7-10 days
10 μg$2467-10 days7-10 days
20 μg$4167-10 days7-10 days
50 μg$8537-10 days7-10 days
100 μg$1,4607-10 days7-10 days
200 μg$1,9807-10 days7-10 days
500 μg$3,3007-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml.
Description
IHH Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q14623.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ14623
Synonyms
Indian hedgehog protein,IHH,HHG-2
Amino Acid
II+GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Construction
28-202 aa
Protein Purity
>96% as determined by SDS-PAGE and HPLC
Molecular Weight19.8 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 1 × PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords