PEX19 Protein, Human, Recombinant (GST)

Name: PEX19 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-01855
Rating: 4.5 (1 reviews)

(Synonyms: PXF, PEX19, Peroxisomal farnesylated protein, Peroxisomal biogenesis factor 19, Peroxin-19, HK33, 33 kDa housekeeping protein) Copy Product Info

Synonyms: PXF, PEX19, Peroxisomal farnesylated protein, Peroxisomal biogenesis factor 19, Peroxin-19, HK33, 33 kDa housekeeping protein

Catalog No. TMPH-01855 Copy Product Info

Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53. PEX19 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 59.3 kDa and the accession number is P40855.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$74	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$196	20 days	20 days
50 µg	$292	20 days	20 days
100 µg	$397	20 days	20 days
200 µg	$618	20 days	20 days
500 µg	$1,120	20 days	20 days
1 mg	$1,760	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/mL can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 μg/mL.
Description	Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53. PEX19 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 59.3 kDa and the accession number is P40855.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P40855
Amino Acid	AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC
Construction	2-296 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PXF, PEX19, Peroxisomal farnesylated protein, Peroxisomal biogenesis factor 19, Peroxin-19, HK33, 33 kDa housekeeping protein
Research Background	Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.

Chemical Properties

Molecular Weight

59.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.