Mopeia virus Pre-GP-C Protein (hFc)

Name: Mopeia virus Pre-GP-C Protein (hFc)
Brand: TargetMol
SKU: TMPH-04514
Rating: 4.5 (1 reviews)

(Synonyms: Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC) Copy Product Info

Synonyms: Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC

Catalog No. TMPH-04514 Copy Product Info

Mopeia virus Pre-GP-C Protein (hFc) is expressed in Mammalian cell. The accession number is P19240.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$726	20 days	20 days
100 μg	$1,150	20 days	20 days
200 μg	$1,770	20 days	20 days
500 μg	$3,130	20 days	20 days
1 mg	$4,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Mopeia virus Pre-GP-C Protein (hFc) is expressed in Mammalian cell. The accession number is P19240.
Species	Mopeia virus (MOPV)
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	P19240
Amino Acid	SIYKDNYEFFSLDLDMSSLNATMPLSCSKNNSHHYIQVGNETGLELTLTNTSIINHKFCNLSDAHRRNLYDKALMSILTTFHLSIPDFNQYEAMSCDFNGGKISVQYNLSHSNYVDAGNHCGTIANGIMDVFRRMYWSTSLSVASDISGTQCIQTDYKYLIIQNTSWEDHCMFSRPSPMGFLSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGRTSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVD
Construction	59-430 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 151 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC

Chemical Properties

Molecular Weight

71.6 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

PreGPC

Related Tags: Mopeia virus Pre-GP-C Protein (hFc) chemical structure | Mopeia virus Pre-GP-C Protein (hFc) molecular weight