Shopping Cart
Remove All
Your shopping cart is currently empty
HACD3 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9P035.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $235 | 20 days | 20 days | |
| 20 μg | $393 | 20 days | 20 days | |
| 50 μg | $568 | 20 days | 20 days | |
| 100 μg | $756 | 20 days | 20 days | |
| 200 μg | $1,080 | 20 days | 20 days | |
| 500 μg | $1,760 | 20 days | 20 days | |
| 1 mg | $2,550 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | HACD3 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9P035. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q9P035 |
| Synonyms | Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3,PTPLAD1,Protein-tyrosine phosphatase-like A domain-containing protein 1,HACD3,Butyrate-induced protein 1 (B-ind1;hB-ind1),BIND1,3-hydroxyacyl-CoA dehydratase 3 (HACD3) |
| Amino Acid | MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY |
| Construction | 1-149 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 24.7 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 181 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.