REG3A Protein, Rat, Recombinant (E.coli, His)

Name: REG3A Protein, Rat, Recombinant (E.coli, His)
Brand: TargetMol
SKU: TMPH-03365
Rating: 4.5 (1 reviews)

(Synonyms: RegIII, Regenerating islet-derived protein III-alpha (Reg III-alpha), Regenerating islet-derived protein 3-alpha, REG-3-alpha, Reg3a, Reg3, Pap2, Pancreatitis-associated protein 2, Lithostathine 3, Islet of Langerhans regenerating protein 3 (REG 3)) Copy Product Info

Synonyms: RegIII, Regenerating islet-derived protein III-alpha (Reg III-alpha), Regenerating islet-derived protein 3-alpha, REG-3-alpha, Reg3a, Reg3, Pap2, Pancreatitis-associated protein 2, Lithostathine 3, Islet of Langerhans regenerating protein 3 (REG 3)

Catalog No. TMPH-03365 Copy Product Info

Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. REG3A Protein, Rat, Recombinant (E.coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 20.5 kDa and the accession number is P35231.

REG3A Protein, Rat, Recombinant (E.coli, His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. REG3A Protein, Rat, Recombinant (E.coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 20.5 kDa and the accession number is P35231.
Species	Rat
Expression System	E. coli
Tag	N-6xHis
Accession Number	P35231
Amino Acid	EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
Construction	26-174 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	RegIII, Regenerating islet-derived protein III-alpha (Reg III-alpha), Regenerating islet-derived protein 3-alpha, REG-3-alpha, Reg3a, Reg3, Pap2, Pancreatitis-associated protein 2, Lithostathine 3, Islet of Langerhans regenerating protein 3 (REG 3)
Research Background

Chemical Properties

Molecular Weight

20.5 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

RegIII-αRegIII-alphaRegIII-aRegenerating islet-derived protein III-α (Reg III-α)Regenerating islet-derived protein III-a (Reg III-a)Regenerating islet-derived protein 3-αRegenerating islet-derived protein 3-aREG-3-αREG3αREG-3-aREG3Reg III-αReg III-alphaReg III-aReg IIIREG 3Pap 2Lithostathine3

Related Tags: REG3A Protein, Rat, Recombinant (E.coli, His) chemical structure | REG3A Protein, Rat, Recombinant (E.coli, His) molecular weight