Home Tools
Log in
Cart

Osteocalcin Protein, Canine, Recombinant (His & KSI)

Catalog No. TMPH-00496

Osteocalcin Protein, Canine, Recombinant (His & KSI) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Osteocalcin Protein, Canine, Recombinant (His & KSI)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Osteocalcin Protein, Canine, Recombinant (His & KSI) is expressed in E. coli.
Species Canine
Expression System E. coli
Tag N-terminal 6xHis-KSI-tagged
Accession Number P81455
Amino Acid YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 1-49 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 20.9 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol