Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FABP3 Protein, Rat, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03291 Copy Product Info
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

FABP3 Protein, Rat, Recombinant (His & Myc)

Catalog No. TMPH-03291
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

FABP3 Protein, Rat, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$75920 days20 days
100 μg$1,25020 days20 days
200 μg$1,97020 days20 days
500 μg$3,78020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Species
Rat
Expression System
HEK293 Cells
TagN-6xHis-Myc
Accession NumberP07483
Synonyms
Heart-type fatty acid-binding protein (H-FABP),heart,Fatty acid-binding protein, heart,Fatty acid-binding protein 3,Fabp3
Amino Acid
ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Construction
2-133 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight18.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords