FABP3 Protein, Rat, Recombinant (His & Myc)

Name: FABP3 Protein, Rat, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03291
Rating: 4.5 (1 reviews)

(Synonyms: Heart-type fatty acid-binding protein (H-FABP), heart, Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Fabp3) Copy Product Info

Synonyms: Heart-type fatty acid-binding protein (H-FABP), heart, Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Fabp3

Catalog No. TMPH-03291 Copy Product Info

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

FABP3 Protein, Rat, Recombinant (His & Myc)

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$238	20 days	20 days
20 µg	$397	20 days	20 days
50 µg	$759	20 days	20 days
100 µg	$1,250	20 days	20 days
200 µg	$1,970	20 days	20 days
500 µg	$3,780	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Species	Rat
Expression System	HEK293 Cells
Tag	N-6xHis-Myc
Accession Number	P07483
Amino Acid	ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Construction	2-133 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Heart-type fatty acid-binding protein (H-FABP), heart, Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Fabp3
Research Background	FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Chemical Properties

Molecular Weight

18.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.