Home Tools
Log in
Cart

COMMD4 Protein, Human, Recombinant (GST)

Catalog No. TMPH-01125
Synonyms: COMM domain-containing protein 4, COMMD4

COMMD4 Protein, Human, Recombinant (GST) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
COMMD4 Protein, Human, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description COMMD4 Protein, Human, Recombinant (GST) is expressed in E. coli.
Species Human
Expression System E. coli
Tag N-terminal GST-tagged
Accession Number Q9H0A8
Synonyms COMM domain-containing protein 4, COMMD4
Amino Acid MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Construction 1-195 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 48.4 kDa as predicted
Formulation Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background N/A

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

COMMD4 Protein, Human, Recombinant (GST) COMM domain-containing protein 4 COMMD4 recombinant recombinant-proteins proteins protein

 

TargetMol