COMMD4 Protein, Human, Recombinant (GST) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 198.00 | |
100 μg | 20 days | $ 389.00 | |
1 mg | 20 days | $ 1,680.00 |
Description | COMMD4 Protein, Human, Recombinant (GST) is expressed in E. coli. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal GST-tagged |
Accession Number | Q9H0A8 |
Synonyms | COMM domain-containing protein 4, COMMD4 |
Amino Acid | MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM |
Construction | 1-195 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 48.4 kDa as predicted |
Formulation | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | N/A |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
COMMD4 Protein, Human, Recombinant (GST) COMM domain-containing protein 4 COMMD4 recombinant recombinant-proteins proteins protein