Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Versican core protein, VCAN, PG-M, Large fibroblast proteoglycan, Glial hyaluronate-binding protein (GHAP), CSPG2, Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2)

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $89 | - | In Stock | |
| 10 µg | $143 | - | In Stock | |
| 20 µg | $237 | - | In Stock | |
| 50 µg | $358 | - | In Stock | |
| 100 µg | $490 | 20 days | 20 days | |
| 200 µg | $755 | 20 days | 20 days | |
| 500 µg | $1,330 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis-B2M, C-Myc |
| Accession Number | P13611 |
| Amino Acid | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN |
| Construction | 3089-3354 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Versican core protein, VCAN, PG-M, Large fibroblast proteoglycan, Glial hyaluronate-binding protein (GHAP), CSPG2, Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) |
| Research Background | May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. |
| Molecular Weight | 47.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.